PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 128aa    MW: 15060.7 Da    PI: 5.3177
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70590.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding353.3e-113576346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rW++++ e +++a++q+G++  ++I + ++ g+t+ q+k+++ k
       EPS70590.1 35 RWSKQDTETFYEAIRQFGTD-LSLIQQLFP-GLTRQQIKLKYKK 76
                     8*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159636.4E-2726110No hitNo description
SMARTSM007177.4E-63280IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-53576IPR009057Homeodomain-like
CDDcd001679.42E-63576No hitNo description
SuperFamilySSF466892.32E-93583IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
SNRENEVGEG DAAAVEDATL YFNYQTYMDK PRPIRWSKQD TETFYEAIRQ FGTDLSLIQQ  60
LFPGLTRQQI KLKYKKEERQ HPFRLHEAVT NRPKDHSHFK MVIERLQQIA AEQNKKEDEE  120
EGGETSEG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619096.13e-49PREDICTED: transcription factor TFIIIB component B'' homolog isoform X3
RefseqXP_011093307.12e-49PREDICTED: transcription factor TFIIIB component B''-like isoform X3
TrEMBLS8CUX23e-92S8CUX2_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000457283e-48(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59022326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-32MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]